PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.819C3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 281aa    MW: 30755.5 Da    PI: 6.4535
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.819C3genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.54e-30134187155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Araip.819C3 134 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 187
                  59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.507131190IPR017930Myb domain
SuperFamilySSF466891.38E-19132191IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-30133192IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23135187IPR006447Myb domain, plants
PfamPF002494.5E-8137186IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGEEVRMTDY QDDDRVADWE LGLPAVHDLT PLSQLLIPPE LASAFSISPE PHRSLVDVNR  60
ASKNTLSTLR TGVNAFSSSN LNPFQDEGND PAGDDEEEIV PDGSGSNSRK LRKVDCAEEA  120
DSVPRTDSAA AVKRPRLVWT PQLHKRFVDV VAHLGIKNAV PKTIMQLMNV EGLTRENVAS  180
HLQKYRLYLK RMQGLSADGP SSSDHLFAST PVPQSLNDSG GGGGSGHSRG NGHLPVPVPM  240
HYPPAAMMPM PMLGMPHGFH HHHVLQQRDW SYPPHVTPND K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-20131192263ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2065788e-59AB206578.1 Oryza sativa Japonica Group OsPCL1 gene for putative transcription factor, complete cds.
GenBankAP0032778e-59AP003277.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0518C01.
GenBankAP0149578e-59AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAY5812568e-59AY581256.1 Oryza sativa (japonica cultivar-group) induced protein MgI1 mRNA, complete cds.
GenBankCP0126098e-59CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016187258.10.0PREDICTED: transcription factor LUX-like
SwissprotQ9SNB46e-85PCL1_ARATH; Transcription factor LUX
TrEMBLF6GUZ01e-121F6GUZ0_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g05120.t011e-121(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69573347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.24e-84G2-like family protein